PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0008
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 216aa    MW: 23963.5 Da    PI: 8.7596
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0008genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.95.8e-1552104355
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                   lkr rr+ +NRe+ArrsR+RK++ +  Le  +++L +eN++L  +l +  ++
  Gh_D07G0008  52 HLKRLRRMLSNRESARRSRKRKQEHLTDLEFLAEQLRGENHSLYRQLTNAHQQ 104
                  58*****************************************9777766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.2E-1149105No hitNo description
SMARTSM003383.0E-1150114IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.27752115IPR004827Basic-leucine zipper domain
PfamPF001706.1E-1352102IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.65E-1154104No hitNo description
CDDcd147021.68E-1655106No hitNo description
PROSITE patternPS0003605772IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MWYQFTILRN NPKAKSRENE VRGATSASSP DHQSDNEETD VAQSEQSLDP SHLKRLRRML  60
SNRESARRSR KRKQEHLTDL EFLAEQLRGE NHSLYRQLTN AHQQFRDADT SNRVLKSDVE  120
ALRAKVKLAE DVLARGSLPC GLNQLVQTQL TSPQTIASHN HSLGRVANVS PTITIHGDVS  180
SNSGLTISGD ISNVNANLNN GTGADAAVSC VSEIWR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16672RRSRKRK
26673RRSRKRKQ
36873SRKRKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9641837e-37JX964183.1 Gossypium hirsutum clone NBRI_TRANS-452 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490502.11e-147PREDICTED: basic leucine zipper 9-like
SwissprotQ9FUD36e-60BZIP9_ARATH; Basic leucine zipper 9
TrEMBLA0A0D2QG651e-148A0A0D2QG65_G
STRINGVIT_04s0008g02750.t012e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63702641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.14e-61basic leucine zipper 9